| Basic Information | |
|---|---|
| Taxon OID | 3300013212 Open in IMG/M |
| Scaffold ID | Ga0172421_107371 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Saiful Muluk Lake, Pakistan |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | BGI Tech Solutions Co., Ltd. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 705 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Saiful Muluk Lake, Pakistan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Saiful Muluk Lake, Naran, Pakistan | |||||||
| Coordinates | Lat. (o) | 34.8762 | Long. (o) | 73.6934 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009750 | Metagenome | 313 | Y |
| F033795 | Metagenome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0172421_1073711 | F009750 | GAG | MILKNAIFEPSHTMKEIVTAIYQNGIFKDNKILKPHLTDRFGIRMKFPEGAECILWTNGKKYYAVCEAFGTIFTVNIPRNLGDDIWDRFKTQFEGN |
| Ga0172421_1073712 | F033795 | N/A | IWLMWSMAVNKKDTVWLFQAEKFAKRYLSLNSNGYRAYEYLGQFYRIMYVDLRLAVRYYESAIRWKDAPSSTHYSLISVCEKSGDKVKAIGYCKMTLTRFPNDPYTKSKLEALTKL* |
| ⦗Top⦘ |