Scaffold Ga0116834_1002939

Overview

Basic Information

• Taxon OID: 3300013188
• Scaffold ID: Ga0116834_1002939
• Source Dataset Name: Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2565
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa

Source Dataset Sampling Location

• Location Name: USA: Gulf of Mexico
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027815	Metagenome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116834_10029396	F027815	GAG	MKDNFQLPDNMFTDNPVFVDTSQEFDEDCGDACKI*