Scaffold Ga0171660_10380280

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0171660_10380280

Scaffold Ga0171660_10380280

Overview

Basic Information
Taxon OID	3300013135 Open in IMG/M
Scaffold ID	Ga0171660_10380280 Open in IMG/M
Source Dataset Name	Petroleum sludge microbial communities from waste storage tank in Noonmati IOCL oil refinery, Guwahati, Assam, India - point GR3 51
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Life Technologies
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	721
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Oil Refinery → Petroleum Sludge → Unclassified → Petroleum Sludge → Petroleum Sludge Microbial Communities From Waste Storage Tank In Noonmati Iocl Oil Refinery, Guwahati, Assam, India

Source Dataset Sampling Location
Location Name	Guwahati, Assam, India
Coordinates	Lat. (^o)	26.18471	Long. (^o)	91.80725	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021262	Metagenome / Metatranscriptome	219	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0171660_103802801	F021262	AGGAG	MSKKYYIKFTTGKELTGTAKEIVTQLRNESRLLAITPRKYARLVAKSYEMSTGLKLRTWTYNSFVKSL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.