| Basic Information | |
|---|---|
| Taxon OID | 3300013134 Open in IMG/M |
| Scaffold ID | Ga0116697_1002023 Open in IMG/M |
| Source Dataset Name | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2900 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand → Beach Sand Microbial Communities From Municipal Pensacola Beach, Florida |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Municipal Pensacola Beach, FL | |||||||
| Coordinates | Lat. (o) | 30.3262 | Long. (o) | -87.1745 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070744 | Metagenome / Metatranscriptome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116697_10020233 | F070744 | GGA | VTVPSNTDDDQLQQICNEIPASDWVRVKNAWRQHQHNDTPRYMRYIHATNEENKRLELFWQRLVAQDFITEEDALLLTENFFQELGGYSDEKAKDMRRKILSRAADRFR |
| ⦗Top⦘ |