NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0171665_1242000

Scaffold Ga0171665_1242000


Overview

Basic Information
Taxon OID3300013124 Open in IMG/M
Scaffold IDGa0171665_1242000 Open in IMG/M
Source Dataset NamePetroleum sludge microbial communities from waste storage tank in Noonmati IOCL oil refinery, Guwahati, Assam, India - point GR3 91
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLife Technologies
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Oil Refinery → Petroleum Sludge → Unclassified → Petroleum Sludge → Petroleum Sludge Microbial Communities From Waste Storage Tank In Noonmati Iocl Oil Refinery, Guwahati, Assam, India

Source Dataset Sampling Location
Location NameGuwahati, Assam, India
CoordinatesLat. (o)26.18471Long. (o)91.80725Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025938Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0171665_12420001F025938N/AMVVIPDKIVDLLSSMFEDVRDKQFIIGDTLIEIVNATGDKSGTIAYLAGRLGVAASTLYDYYRIAKLWTPEYRAMYQALDWTIYRNADPNDPEDRALLDRCIDEQWSSATFKENKYPALKDPRVIVGRMIALGKRIYEQDTLEMSRSFSENHVLVKGNNFIISDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.