| Basic Information | |
|---|---|
| Taxon OID | 3300013121 Open in IMG/M |
| Scaffold ID | Ga0172278_1393 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Jimei wastewater treatment plant (WWTP), Xiamen City, Fujian province, China |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 145179 |
| Total Scaffold Genes | 130 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 82 (63.08%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Jimei Wastewater Treatment Plant (Wwtp), Xiamen City, Fujian Province, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Jimei WWTP, Xiamen City, Fujian province | |||||||
| Coordinates | Lat. (o) | 24.25 | Long. (o) | 117.57 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076269 | Metagenome / Metatranscriptome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0172278_139378 | F076269 | AGGAGG | MTFLLWLFFTALAVGIPPAFIARQLTKGRGQYVEIPGKAVTWGVGSFLLAYLAVTVPWLIISWTGLIGAPWLFTGLILGAPASAWASKKWYRAMKDGSLPGGGSNKYLP* |
| ⦗Top⦘ |