NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164318_10912235

Scaffold Ga0164318_10912235


Overview

Basic Information
Taxon OID3300013103 Open in IMG/M
Scaffold IDGa0164318_10912235 Open in IMG/M
Source Dataset NameSubseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)728
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → unclassified Methanomicrobia → Methanomicrobia archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico

Source Dataset Sampling Location
Location NameMexico: Gulf of California
CoordinatesLat. (o)27.0183Long. (o)-111.3802Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042112Metagenome158N

Sequences

Protein IDFamilyRBSSequence
Ga0164318_109122351F042112N/AKKMSYDEYSPTPLPSEEEKYISKLAYPHLLFIQMQRIMDAINAGDDGKEELENLKALLKPSWREEIDAKMETYEKRMEKEIEEATKVKEKVGITTYREMKRLAKVRYVRRYVQYVIEKLDEVGLLLIEERTVLRGGGLVT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.