Scaffold Ga0157371_10646839

Overview

Basic Information

• Taxon OID: 3300013102
• Scaffold ID: Ga0157371_10646839
• Source Dataset Name: Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 789
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089076	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157371_106468391	F089076	N/A	RIAFIIATVAGIALGCLRYYTSGKIYKSRLILHSSFLTNLEEIEIINYWNELLKRNEYTALAQSFNCDENMLHDVLSIEGSEILKNYSASNPNGFYIDARIKDNAVLPGLQKALVYGLNNTEYVKQRLLLRKKDVETLIEKVTAEIQKLDSLKKNIETVITSGEKNATSFMLDIPGINKEFIDMNEKLLSYREELQFSSSGIQVLQSFVSLNTPVSISLKVMILLGILFCLFIAFIFTITNSVSERLKKRASSNA*