| Basic Information | |
|---|---|
| Taxon OID | 3300013101 Open in IMG/M |
| Scaffold ID | Ga0164313_10019040 Open in IMG/M |
| Source Dataset Name | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5863 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: Gulf of California | |||||||
| Coordinates | Lat. (o) | 27.0151 | Long. (o) | -111.3798 | Alt. (m) | Depth (m) | 2000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084255 | Metagenome / Metatranscriptome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164313_100190404 | F084255 | N/A | MESSKRYLLQAEIEYWHEMLYLNKSRMSKSREEEMRACLKTAVRAMNSNSIGDFRAAA* |
| ⦗Top⦘ |