Scaffold Ga0164315_10326392

Overview

Basic Information

• Taxon OID: 3300013099
• Scaffold ID: Ga0164315_10326392
• Source Dataset Name: Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1248
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Gulf of California
• Coordinates
  • Lat. (^o): 27.0151
  • Long. (^o): -111.3798
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041433	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164315_103263923	F041433	GGA	MTNIEFNKIANELDTLAKNTMNAKGPEYTQQDKDILANFKNTAVRLNTTDLKVWGAYFDKQVSSIYAHLNNANLKKAESIESRFADIINYCHLGLALFKERSK*