Basic Information | |
---|---|
Taxon OID | 3300013098 Open in IMG/M |
Scaffold ID | Ga0164320_10113327 Open in IMG/M |
Source Dataset Name | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1187 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Gulf of California | |||||||
Coordinates | Lat. (o) | 27.009 | Long. (o) | -111.4081 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060433 | Metagenome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164320_101133271 | F060433 | N/A | MEMFSSVLEPLLLAAFIGMGSGLFAFFRKMSNTQRDLCETVKRLQKTLIILAKAVDRQSNRLHPDEANSELDDLVEELLDE* |
⦗Top⦘ |