NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164296_1013154

Scaffold Ga0164296_1013154


Overview

Basic Information
Taxon OID3300013093 Open in IMG/M
Scaffold IDGa0164296_1013154 Open in IMG/M
Source Dataset NameDystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5905
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005167Metagenome / Metatranscriptome410Y
F009741Metagenome / Metatranscriptome313Y
F019092Metagenome / Metatranscriptome231Y
F025484Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0164296_101315410F019092GGAGMSNIPILGQRQQQPTDPVFRLLHCLVCDTLEELPPYDGPSDKDTLLEIACEVHVFPSGEPHKGKLYVLPLKYWAKTESKREIIRQLKGGGSKGLAEVDESYYDSRSTFMDDAMACYRQHNRPKDGCGDWHTQQKMLVPKTVKERRAEGMARYQDEAGPKTYLCDFCPVAVAVNTRKQKLLGGRP*
Ga0164296_10131546F009741GGAMTQSFDGNYDYTKSWRAPVQPDQVAKKWSYNGPWSSNMERLTSQALMVASIPAADIQAMVRPPLPQIRLFPDRFGYGPRVQPGIEDIVSVDRNYQEPRISWYSGSPAGYSGSSRNDLGNN
Ga0164296_10131547F025484AGGAMPGTGDDSGNLTMDLQAKQIMENATRYNGSAPCPTCGVIMNPVEFMTNRGHCLDCLNQAKVARVKGKMA*
Ga0164296_10131548F005167AGGMAVNSSRSMNQSLDAGATDGRYRKARPDTEVAVGSGNDETLANRQTLNPFWGYDFITSEYPNKVNPGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.