Scaffold Ga0163203_1257970

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163203_1257970

Scaffold Ga0163203_1257970

Overview

Basic Information
Taxon OID	3300013089 Open in IMG/M
Scaffold ID	Ga0163203_1257970 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	537
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Canada: British Columbia
Coordinates	Lat. (^o)	50.0621	Long. (^o)	-124.7214	Alt. (m)		Depth (m)	330
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089760	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163203_12579702	F089760	N/A	LAIFSESLAGPNSQVNFMKKPLFVLVLVVLASSLQAQAQSPQQVLAAMGTIQGNPKFVAASKAVSNAPTPEDQIQARRALAQLKLDLIEQQDPSLKPVIDNIRAAQSAVLR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.