Scaffold Ga0163212_1102665

Overview

Basic Information

• Taxon OID: 3300013087
• Scaffold ID: Ga0163212_1102665
• Source Dataset Name: Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 919
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Malawi: Central Region
• Coordinates
  • Lat. (^o): -13.5167
  • Long. (^o): 34.7703
  • Depth (m): 45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003601	Metagenome / Metatranscriptome	477	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163212_11026651	F003601	GGCGG	MTNDYTDDQLLAMAMANIGEFIHDNSPHYVLIEDDPRNEEDYDTWAYGTEPLPYDHTWRSTSIEVDVSPSAPE*