NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153913_1221425

Scaffold Ga0153913_1221425


Overview

Basic Information
Taxon OID3300013080 Open in IMG/M
Scaffold IDGa0153913_1221425 Open in IMG/M
Source Dataset NameFreshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)565
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie, Old Woman Creek
CoordinatesLat. (o)41.3778Long. (o)-82.5108Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043157Metagenome / Metatranscriptome157Y
F067247Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0153913_12214251F043157N/ASDERFRDCICLNIYDRIDSMQMLGELVMIKRAKSFERRIR*
Ga0153913_12214252F067247AGGAGGVRKLLSIGIVLALLVTFVVPVVVAAQDDECCDYTPPEATPMPDRTTKTLAGATMWTLLGTMDIMGGAVCAVTGQLAANLGGWSDELGVIAVDVTASALSGVGDLIPALLSALGLTAFEDLGTQLGNFLESIAEALRGAAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.