| Basic Information | |
|---|---|
| Taxon OID | 3300013071 Open in IMG/M |
| Scaffold ID | Ga0164273_1031884 Open in IMG/M |
| Source Dataset Name | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C Kraft OP (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1153 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Emeryville, California | |||||||
| Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034415 | Metagenome / Metatranscriptome | 175 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164273_10318843 | F034415 | GGA | MTGAPGHKKSQHLIEAEAYRRIMAGEAPETLGAFAQQLLDWLQTAYPGAVPGSLATVEEQIRETWDRRHDLIRGG* |
| ⦗Top⦘ |