Basic Information | |
---|---|
Taxon OID | 3300013060 Open in IMG/M |
Scaffold ID | Ga0157580_114485 Open in IMG/M |
Source Dataset Name | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES085 metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1006 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051875 | Metagenome / Metatranscriptome | 143 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157580_1144851 | F051875 | N/A | IYYWCINMSSTISTLEEVANQFQVWRDNKKNSKFFPIPPHLKAHARQLLTSYSISQVAAALNISRSFLYNIQKDKISLLDNKNQQTSGTESLNFIPFNFVDPNQQKKNHLINPAPPLKFTCEIIKPNGIKLIIHTSDPTSIINTFLCSN* |
⦗Top⦘ |