| Basic Information | |
|---|---|
| Taxon OID | 3300013042 Open in IMG/M |
| Scaffold ID | Ga0164268_129587 Open in IMG/M |
| Source Dataset Name | Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig BY (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 988 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Emeryville, California | |||||||
| Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003009 | Metagenome / Metatranscriptome | 513 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164268_1295871 | F003009 | N/A | TIFNLVRYFAVLSVSFHDVNSLFGFFILLTVFSQLVSGTMLSFSLIPEPMLVPIVRDEEDLEDLYTDDFF* |
| ⦗Top⦘ |