Basic Information | |
---|---|
Taxon OID | 3300013027 Open in IMG/M |
Scaffold ID | Ga0170683_10105176 Open in IMG/M |
Source Dataset Name | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Monturaqui |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Johns Hopkins Bayview Research CORES |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 736 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Chile: Atacama Desert | |||||||
Coordinates | Lat. (o) | -23.57431 | Long. (o) | -68.10215 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002864 | Metagenome / Metatranscriptome | 525 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0170683_101051761 | F002864 | AGG | VIEAGPVRIPRDVLEELESVRLYARTEVLDIPTLRYVAMERDKPALVVWIDRHAPEYGRGLLDGFQVEE* |
⦗Top⦘ |