| Basic Information | |
|---|---|
| Taxon OID | 3300013026 Open in IMG/M |
| Scaffold ID | Ga0170681_1087781 Open in IMG/M |
| Source Dataset Name | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Johns Hopkins Bayview Research CORES |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 610 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Site Cordon de Lila - Atacama Desert, Chile | |||||||
| Coordinates | Lat. (o) | -23.53976 | Long. (o) | -68.68737 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083787 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170681_10877812 | F083787 | AGGAGG | MGKIRQPVGAPGWLWVILAVAAMGFSLGHTVADLGIIFGSLSSSFGVPQILLSALIGALYTWWAWVFAKAVGGAKSWLVGLMVFDILWVGGNGLTIFACPPPCSAVP |
| ⦗Top⦘ |