Scaffold Ga0157367_1237702

Overview

Basic Information

• Taxon OID: 3300013025
• Scaffold ID: Ga0157367_1237702
• Source Dataset Name: Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 637
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: Brazil: Botucatu, State of Sao Paulo
• Coordinates
  • Lat. (^o): -22.847
  • Long. (^o): -48.434

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009830	Metagenome / Metatranscriptome	312	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157367_12377021	F009830	AGGA	MLDKRLEQEQAPRVDERLARVVRIIVEQYDGDVKAFVESNRYRIEANRKAEAVSDHGDEAPLRKCPSTTRIIGRISSARYS*