| Basic Information | |
|---|---|
| Taxon OID | 3300013024 Open in IMG/M |
| Scaffold ID | Ga0170682_1058425 Open in IMG/M |
| Source Dataset Name | Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HE |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Johns Hopkins Bayview Research CORES |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 726 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chile: Atacama Desert | |||||||
| Coordinates | Lat. (o) | -20.43644 | Long. (o) | -69.58397 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090177 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170682_10584251 | F090177 | N/A | IGMEIVLRTKTPEGIEVVLPALVYAKIVDEHAAVSDLDLIDRTVREPDERRPDARPGRERFFRREGRLWVLAVVDFVGVPAIIVTAFSTERPAV* |
| ⦗Top⦘ |