Scaffold Ga0170682_1015926

Overview

Basic Information

• Taxon OID: 3300013024
• Scaffold ID: Ga0170682_1015926
• Source Dataset Name: Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HE
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Johns Hopkins Bayview Research CORES
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1756
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location

• Location Name: Chile: Atacama Desert
• Coordinates
  • Lat. (^o): -20.43644
  • Long. (^o): -69.58397

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085140	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170682_10159261	F085140	AGGA	MKRILGRLLVLGVAAGAVYALRNYLESSSARASRGDVQLTLDNGASVEPSSAEAQEFVDIARKVLEIAG*