Basic Information | |
---|---|
Taxon OID | 3300013023 Open in IMG/M |
Scaffold ID | Ga0157366_1147124 Open in IMG/M |
Source Dataset Name | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 666 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: Botucatu, State of Sao Paulo | |||||||
Coordinates | Lat. (o) | -22.846 | Long. (o) | -48.436 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010740 | Metagenome | 300 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157366_11471241 | F010740 | GGA | VATAFMERKYNMNTARNGLQIHMFQGGLLHKPYFIAIDNKDQVIIGPSKKIVATHVVGELEVLV* |
⦗Top⦘ |