Scaffold Ga0157366_1008172

Overview

Basic Information

• Taxon OID: 3300013023
• Scaffold ID: Ga0157366_1008172
• Source Dataset Name: Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2877
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: Brazil: Botucatu, State of Sao Paulo
• Coordinates
  • Lat. (^o): -22.846
  • Long. (^o): -48.436

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010740	Metagenome	300	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157366_10081721	F010740	GGA	VATAFLNRKHNTDIARNGYQIHMFQGGPPHEPYFIAKDNKDQIIIGPSKKIVAIHVVGELEVLV