Scaffold Ga0164295_10327597

Overview

Basic Information

• Taxon OID: 3300013014
• Scaffold ID: Ga0164295_10327597
• Source Dataset Name: Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1158
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.008
  • Long. (^o): -89.701
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080028	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164295_103275972	F080028	N/A	MIDYLLAFFAIFFADIFYTYYLKAVHEEQTVKASAWAVVVYVIAAVAIIEYNSNHMLLIPAAVGAFCGTFVGIKLRKR*