Scaffold Ga0164295_10042251

Overview

Basic Information

• Taxon OID: 3300013014
• Scaffold ID: Ga0164295_10042251
• Source Dataset Name: Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3442
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.008
  • Long. (^o): -89.701
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104710	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164295_100422512	F104710	GGGGG	MPITQTAISVGTALVQVVAPDINSVKVTLHNLESVASRQIWVGGSGLVQGQSVHINSANILQLALDPGDALYAVTTSGTYSLGVIVQKQD*