Scaffold Ga0169969_1039610

Overview

Basic Information

• Taxon OID: 3300013013
• Scaffold ID: Ga0169969_1039610
• Source Dataset Name: Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Monturaqui
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Johns Hopkins Bayview Research CORES
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1124
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. XY-223 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location

• Location Name: Chile: Atacama Desert
• Coordinates
  • Lat. (^o): -23.57431
  • Long. (^o): -68.10215

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086329	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169969_10396101	F086329	GAGG	MTMRLAALGGSPGVLERLIRREDLCGDEAAAARAALLRSLGFEKVRVVFEQPPAT*