Scaffold Ga0169969_1033363

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169969_1033363

Scaffold Ga0169969_1033363

Overview

Basic Information
Taxon OID	3300013013 Open in IMG/M
Scaffold ID	Ga0169969_1033363 Open in IMG/M
Source Dataset Name	Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Monturaqui
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Johns Hopkins Bayview Research CORES
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1254
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location
Location Name	Chile: Atacama Desert
Coordinates	Lat. (^o)	-23.57431	Long. (^o)	-68.10215	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054147	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0169969_10333633	F054147	AGGAGG	MGQRDHDKDQEIDQAGERGGDTGHASKKGDGPGAERGDWRRDKPVHSGPTRRGSQGSDSKHGKRSGSDSNAS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.