| Basic Information | |
|---|---|
| Taxon OID | 3300013012 Open in IMG/M |
| Scaffold ID | Ga0169965_1012430 Open in IMG/M |
| Source Dataset Name | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Johns Hopkins Bayview Research CORES |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2161 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chile: Atacama Desert | |||||||
| Coordinates | Lat. (o) | -23.53976 | Long. (o) | -68.68737 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002628 | Metagenome | 542 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0169965_10124302 | F002628 | GAG | MFSEGSSGGGEEHVFTGRAAIGYDHGYDGEVFYLGLALDERYVEGWVEGCLERIGEDYPEEERLFRDLWEDESQREVVVESLKADCEVRRGRPRW* |
| ⦗Top⦘ |