Basic Information | |
---|---|
Taxon OID | 3300013005 Open in IMG/M |
Scaffold ID | Ga0164292_10414319 Open in IMG/M |
Source Dataset Name | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 897 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.099 | Long. (o) | -89.405 | Alt. (m) | Depth (m) | 7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056323 | Metagenome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164292_104143192 | F056323 | GAG | MIRLFSLHEIAEDLKLPPAVVALWAADGMIPHTMREGMPLFDPVAVGKHIAEQLNNLNKYDDEA* |
⦗Top⦘ |