NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164292_10126489

Scaffold Ga0164292_10126489


Overview

Basic Information
Taxon OID3300013005 Open in IMG/M
Scaffold IDGa0164292_10126489 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1895
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006135Metagenome / Metatranscriptome380N
F013755Metagenome / Metatranscriptome268Y
F016253Metagenome / Metatranscriptome248Y

Sequences

Protein IDFamilyRBSSequence
Ga0164292_101264891F006135N/AMSVRIKIENQTEVPVLVALFEQPKCNDHPTRSAVLKPGESCDWGSGSVPLGNYQCYAVMSGDASSHDEWVWHFPGIAEVVAPLELGFKLWHAGDIDWANVKAMSSDDLNATFGSTYTSAKSSTKSWNGMSSCIFHVRGG
Ga0164292_101264895F013755GAGGVSDTPISDSTPHNVAELGMLCRRLERKLAATRKYLGDVSERVKQLETENDAMRADLLLWNEKEVKL*
Ga0164292_101264898F016253N/AFIDSGTGVYSISKKEAGEIHKAAKKVKNYAFSYWTRNRKAKEAK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.