| Basic Information | |
|---|---|
| Taxon OID | 3300013004 Open in IMG/M |
| Scaffold ID | Ga0164293_10113872 Open in IMG/M |
| Source Dataset Name | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2057 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.099 | Long. (o) | -89.405 | Alt. (m) | Depth (m) | 7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002302 | Metagenome | 573 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164293_101138722 | F002302 | GGTGG | VPAPYTDLFNEALDDLTATLTAVTGLRVVNDPTRLVPNCVYITAPSFTTIAGNGNIVRVDYPIKIVGSGPAGLPVLREILQITALVLGSSVIAMSGRPGTLDIGGQEYPCYDVAVGLQAQSS* |
| ⦗Top⦘ |