Scaffold Ga0164293_10022722

Overview

Basic Information

• Taxon OID: 3300013004
• Scaffold ID: Ga0164293_10022722
• Source Dataset Name: Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5232
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.099
  • Long. (^o): -89.405
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054609	Metagenome / Metatranscriptome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0164293_100227225	F054609	N/A	MNSLIQNAVARGWISFPHPAAVTAHPDVVKARLNSPDYNAQRAWKLWNEGQSLAYVAKAVGVKKRCVMAIIEEGKSKAKGEK*