| Basic Information | |
|---|---|
| Taxon OID | 3300013002 Open in IMG/M |
| Scaffold ID | Ga0157364_1027445 Open in IMG/M |
| Source Dataset Name | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5211 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Leucoagaricus → Leucoagaricus leucothites | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: Ribeirao Preto, State of Sao Paulo | |||||||
| Coordinates | Lat. (o) | -21.165 | Long. (o) | -47.853 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020830 | Metagenome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157364_10274451 | F020830 | N/A | KGTIATFGFPLTPFCPKSSQNPTDDVALSCLYDNASLHQVLPIKDDASPSLLPSRIFFGLPYHTLDAAL* |
| ⦗Top⦘ |