Scaffold Ga0157360_1006493

Overview

Basic Information

• Taxon OID: 3300013000
• Scaffold ID: Ga0157360_1006493
• Source Dataset Name: Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4082
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Phallomycetidae → Geastrales → Sphaerobolaceae → Sphaerobolus → Sphaerobolus stellatus → Sphaerobolus stellatus SS14 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: Brazil: Ribeir?o Preto, State of S?o Paulo
• Coordinates
  • Lat. (^o): -21.165
  • Long. (^o): -47.848

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002577	Metagenome	546	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157360_10064932	F002577	N/A	VVGSSFQSIDRICFYIYREEVQPELLFQVSPGLDGENASVCFLMEYVFRPLGSMISFEERESPENPFLFIMELLWG*