Scaffold Ga0157363_1030794

Overview

Basic Information

• Taxon OID: 3300012999
• Scaffold ID: Ga0157363_1030794
• Source Dataset Name: Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4572
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (41.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: Brazil: Ribeir?o Preto, State of S?o Paulo
• Coordinates
  • Lat. (^o): -21.164
  • Long. (^o): -47.857

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093008	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157363_10307942	F093008	N/A	MEEASRKLNTKAYVMTLKEEEALNQWLDEQLKAGLIVELKSKYTALCFYILKKNSSLQLV