| Basic Information | |
|---|---|
| Taxon OID | 3300012990 Open in IMG/M |
| Scaffold ID | Ga0159060_1085826 Open in IMG/M |
| Source Dataset Name | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 842 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022156 | Metagenome / Metatranscriptome | 215 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0159060_10858263 | F022156 | AGGA | MANEIEKEIVKEAIKEWLNEKVTQFGWFSIRTLFYVFVAGLGYA* |
| ⦗Top⦘ |