Basic Information | |
---|---|
Taxon OID | 3300012990 Open in IMG/M |
Scaffold ID | Ga0159060_1011684 Open in IMG/M |
Source Dataset Name | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2266 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015 |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Alberta | |||||||
Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096674 | Metagenome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0159060_10116847 | F096674 | GGAG | MTQYVQFDLVDEMQWEDVADEAGLFVSLEFAGFEESANDEPLHGIHHGSSGSIYSYTSWFYDGDDSAFSVA* |
⦗Top⦘ |