Scaffold Ga0159060_1001567

Overview

Basic Information

• Taxon OID: 3300012990
• Scaffold ID: Ga0159060_1001567
• Source Dataset Name: Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6318
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015

Source Dataset Sampling Location

• Location Name: Canada: Alberta
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040081	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0159060_10015671	F040081	GAGG	LDPITLLATASAIWSGLKKASEFAAEAEGVWGQLSKYCGVADQLEQVIQTEKNKPKKLKLFQSLTPGNDTQEAFNVFEAEHKLMQLERDIRHEFIYGSFCNLQGG