NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164307_11456852

Scaffold Ga0164307_11456852


Overview

Basic Information
Taxon OID3300012987 Open in IMG/M
Scaffold IDGa0164307_11456852 Open in IMG/M
Source Dataset NameSoil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)578
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Mt. Pleasant research farm, Cornell University, New York
CoordinatesLat. (o)42.4531Long. (o)-76.3842Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034224Metagenome / Metatranscriptome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0164307_114568522F034224GGALGSPVEFQIMVNGLVSALLIIAGGGCAVAGYVLGSWHQRRAMEAELAGDLFGDRTLDFTDEPAPRRDQRLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.