Scaffold Ga0123349_11417462

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0123349_11417462

Scaffold Ga0123349_11417462

Overview

Basic Information
Taxon OID	3300012983 Open in IMG/M
Scaffold ID	Ga0123349_11417462 Open in IMG/M
Source Dataset Name	Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C2 Day 2 Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location Name	Point Reyes National Seashore, California, USA
Coordinates	Lat. (^o)	38.04	Long. (^o)	-122.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056212	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0123349_114174621	F056212	GGAG	MTFKKFAEIAAIHRPDVVVHAHKSFGGVQDVAIYFKHPDGRKSRVYSYRGSYADILNRLGIKVITQTDVATAEAQLRMAKKAHGKPSLFGKGAIRDCSKEIAELTELLRRYQTDEFVRDWE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.