NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123349_10076778

Scaffold Ga0123349_10076778


Overview

Basic Information
Taxon OID3300012983 Open in IMG/M
Scaffold IDGa0123349_10076778 Open in IMG/M
Source Dataset NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C2 Day 2 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2296
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location NamePoint Reyes National Seashore, California, USA
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072921Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0123349_100767784F072921N/AMKKQMTLSTDRKSASEGEYLDIRWECNACPDSLYLSVDSGYQQYSIAVADNGSTRLAMGRSKGKTTISLIGVISGKKVTESVEIRIKNRKESRKAKAPLSTRMKAFGEKMQAKWYVFRAQMKYWWISQKKWQKALWIALLAIWLGLLFASLGGRPEPVTSSDQVEGLMQV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.