| Basic Information | |
|---|---|
| Taxon OID | 3300012982 Open in IMG/M |
| Scaffold ID | Ga0168317_1006443 Open in IMG/M |
| Source Dataset Name | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4283 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings → Weathered Mine Tailings Microbial Communities From Hibbing, Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hibbing, MN, USA | |||||||
| Coordinates | Lat. (o) | 47.432362 | Long. (o) | -92.940835 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000239 | Metagenome / Metatranscriptome | 1488 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168317_10064434 | F000239 | GGAGG | MDDARRRVIRFLEKEIKTYMALSLFLSKKGIKEHVRVGEKRVLISPTFYKERMKEAKKLVYELRKPS* |
| ⦗Top⦘ |