Scaffold Ga0168316_107633

Overview

Basic Information

• Taxon OID: 3300012981
• Scaffold ID: Ga0168316_107633
• Source Dataset Name: Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2072
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings → Weathered Mine Tailings Microbial Communities From Hibbing, Minnesota, Usa

Source Dataset Sampling Location

• Location Name: Hibbing, MN, USA
• Coordinates
  • Lat. (^o): 47.432362
  • Long. (^o): -92.940835

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078896	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0168316_1076332	F078896	AGG	MSVQVDIEYLVNALRAGIGLVPPMLVAIVLLGGPTAGWLLYRFVVQPRTRRLRGKDASAMWVCPSCRSVNELRMARCYRCDALPDEEELELIDAHPTGPIRLTPVGPTLDLGGPSASQPRPISRIERAEEVWVEEETWERLEARRDRAALPDVAAMTEVAEASGGRRVGRPSAPIPVGPGRPPVARPAVARPRRAVVVGPAASPAEDPDGTPAA*