Basic Information | |
---|---|
Taxon OID | 3300012979 Open in IMG/M |
Scaffold ID | Ga0123348_10175678 Open in IMG/M |
Source Dataset Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung B1 Day 1 Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1166 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Point Reyes National Seashore, California, USA | |||||||
Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058575 | Metagenome / Metatranscriptome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0123348_101756781 | F058575 | N/A | MEAVKLLERADKLRREGRFGEAINAYRAAAASEDCPEDIKKISLASVELMQEINGFVNVDLMNP* |
⦗Top⦘ |