Scaffold Ga0123348_10004078

Overview

Basic Information

• Taxon OID: 3300012979
• Scaffold ID: Ga0123348_10004078
• Source Dataset Name: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung B1 Day 1 Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9186
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location

• Location Name: Point Reyes National Seashore, California, USA
• Coordinates
  • Lat. (^o): 38.04
  • Long. (^o): -122.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072921	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123348_100040781	F072921	N/A	MKSKLSLSTDRKSASEGEYIEIRWSCDACPDSLYLSIDSGCTQYSIAVSDSGTTRIPVPRSNGKMTVKLIGVISGKKVTESIDVRVKVAKRAKSKAPLSSRMKMFGEKMKAKWYVFRANMKYWWISQKKWQKALWIALLALWLGLLFSSIGRKPEVNVSPDQIQTAYLMQ*