| Basic Information | |
|---|---|
| Taxon OID | 3300012978 Open in IMG/M |
| Scaffold ID | Ga0157393_12862 Open in IMG/M |
| Source Dataset Name | Hot spring water viral communities from Western Cape, South Africa - Brandvlei |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of the Western Cape |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2033 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Water → Hot Spring Water Viral Communities From Western Cape, South Africa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Western Cape, South Africa | |||||||
| Coordinates | Lat. (o) | -33.732496 | Long. (o) | 19.413317 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093488 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157393_128622 | F093488 | AGGAGG | MADGLFYWDTREPFIGADIASVTLSTTDVALYPPSNFPVLGGQYWSRVGKKIRIRLFGRMTTGATPGNLTFDIYYGSGANATGTILASSAAVALTASQTNLSWMCEVTVHCRSIGSSGTLFCVGWALFNPSLIASTNQPILIPASAPVVSAAVDLTAANIISIQAKRSGSTTETMQVHDMEVVAMN* |
| ⦗Top⦘ |