| Basic Information | |
|---|---|
| Taxon OID | 3300012973 Open in IMG/M |
| Scaffold ID | Ga0123351_1317341 Open in IMG/M |
| Source Dataset Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Day 36 Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 574 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Point Reyes National Seashore, California, USA | |||||||
| Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058575 | Metagenome / Metatranscriptome | 134 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123351_13173411 | F058575 | N/A | NAKELLERAEELRRNNRFGDAINYYKAAAEAPDATDEIVRKSLASAELMQEINSFVNVDLMNP* |
| ⦗Top⦘ |