Scaffold Ga0153916_11429412

Overview

Basic Information

• Taxon OID: 3300012964
• Scaffold ID: Ga0153916_11429412
• Source Dataset Name: Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 768
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Komeilibacteria → Candidatus Komeilibacteria bacterium CG11_big_fil_rev_8_21_14_0_20_36_20 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location

• Location Name: USA: Ohio, Lake Erie, Old Woman Creek
• Coordinates
  • Lat. (^o): 41.3778
  • Long. (^o): -82.5108
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101126	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153916_114294122	F101126	AGGAGG	MAKFIVELWLDGYETEEEMEKACEEFILEQLDMTASSVKVTKISEEDNIKSPHPA*